Catalog Peptides

Search Results

Product Name Catalog# Sequence M.W. Size
Pheromone Biosynthesis-Activating Neuropeptide (PBAN Hez) (Heliothis zea) AGP-8758 LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL-NH2 3898.8 1.0
Neuropeptide GE (Human) AGP-8502 GSVDFPAENGVQNTESTQE 2009.1 1.0
Neuropeptide GE / NGE (Rat) AGP-8503 GPAVFPAENGVQNTESTQE 1975.1 1.0
Neuropeptide GE (Mouse) AGP-8504 GSVAVFPAENGVQNTESTQE 2064.2 1.0
Neuropeptide EI (NEI) AGP-8505 EIGDEENSAKFPI-NH2 1447.6 1.0
Neuropeptide AF (huNPAF) (Human) AGP-8528 AGEGLNSQFWSLAAPQRF-NH2 1978.2 1.0
Neuropeptide FF (huNPFF) (Human) AGP-8529 SQAFLFQPQRF-NH2 1367.6 1.0
Morphine Modulating Neuropeptide / A18Fa / Neuropeptide AF / bNPAF (Bovine) AGP-8530 AGEGLSSPFWSLAAPQRF-NH2 1920.2 1.0
Morphine Modulating Neuropeptide (F8Fa) / Neuropeptide FF (bNPFF) (Bovine) AGP-8531 FLFQPQRF-NH2 1081.3 1.0
Neuropeptide F (Monieza expansa) AGP-8714 PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2 4590.4 1.0
[Des-Br]-Neuropeptide B-23 (NPB-23) / L7 (Human) AGP-8716 WYKPAAGHSSYSVGRAAGLLSGL 2348.7 1.0
Neuropeptide W-23 (NPW-23) / L8 (Human) AGP-8718 WYKHVASPRYHTVGRAAGLLMGL 2584.1 1.0
[Des-Br]-Neuropeptide B-29 (NPB-29) (Human) AGP-8719 WYKPAAGHSSYSVGRAAGLLSGLRRSPYA 3079.5 1.0
Neuropeptide W-30 (NPW-30) (Human) AGP-8722 WYKHVASPRYHTVGRAAGLLMGLRRSPYLW 3543.2 1.0
Neuropeptide W-23 (NPW-23) (Rat) AGP-8723 WYKHVASPRYHTVGRASGLLMGL 2600.1 1.0
Neuropeptide W-23 (NPW-23) (Porcine) AGP-8724 WYKHTASPRYHTVGRAAGLLMGL 2586.0 1.0
Neuropeptide S (NPS) (Rat) AGP-8772 SFRNGVGSGVKKTSFRRAKQ 2210.5 1.0
Neuropeptide S (NPS) (Human) AGP-8773 SFRNGVGTGMKKTSFQRAKS 2187.5 1.0
Neuropeptide S (NPS) (Mouse, 1-15) AGP-8774 SFRNGVGSGAKKTSF 1542.7 1.0
Neuropeptide S (NPS) (Rat, 1-15) AGP-8775 SFRNGVGSGVKKTSF 1570.8 1.0
[Tyr10]-Neuropeptide S (NPS) (Rat, Mouse) AGP-8776 SFRNGVGSGYKKTSFRRAKQ 2274.6 1.0
Neuropeptide S (NPS) (Mouse) AGP-8792 SFRNGVGSGAKKTSFRRAKQ 2182.5 1.0
Neuropeptide S (NPS) (Chimpanzee, Canine) AGP-8806 SFRNGVGTGMKKTSFRRAKS 2215.5 1.0
Neuropeptide S (NPS) (Chicken) AGP-8807 SFRNGVGSGIKKTSFRRAKS(2183.50) 2183.5 1.0
Neuropeptide Y (NPY) AGP-8091 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 4272.7 1.0
Neuropeptide Y (NPY) Free Acid (Human) AGP-8538 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY 4272.7 1.0
Neuropeptide Y (NPY) (Porcine) AGP-8539 YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 4253.7 1.0
Neuropeptide Y (NPY) (Porcine, 2-36) AGP-8540 PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 4090.5 1.0
Neuropeptide Y (NPY) (Porcine, 16-36) AGP-8542 DLARYYSALRHYINLITRQRY-NH2 2685.1 1.0
Neuropeptide Y (NPY) (Porcine, 18-36) AGP-8543 ARYYSALRHYINLITRQRY-NH2 2456.8 1.0
Neuropeptide Y (NPY) (Porcine, 20-36) AGP-8544 YYSALRHYINLITRQRY-NH2 2229.6 1.0
Neuropeptide Y (NPY) (Porcine, 22-36) AGP-8545 SALRHYINLITRQRY-NH2 1903.2 1.0
[D-Trp32]-Neuropeptide Y (NPY) (Porcine) AGP-8546 YPSKPDNPGEDAPAEDLARYYSALRHYINLIdWRQRY-NH2 4338.8 1.0
Neuropeptide Y (NPY) (Porcine, 3-36) AGP-8547 SKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 3993.4 1.0
TIP 39 (Tuberoinfundibular Neuropeptide) AGP-8661 SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP 4504.2 1.0