PEPTIDES

Catalog Peptides

Overview

Vasoactive Intestinal Peptides (VIP)
Product Name Catalog# Sequence M.W. Size
VIP (Human, Porcine, Rat, Ovine, 10-28) AGP-8084 YTRLRKQMAVKKYLNSILN-NH2 2338.8 1.0
PHM-27 (Human) AGP-8295 HADGVFTSDFSKLLGQLSAKKYLESLM-NH2 2985.4 1.0
VIP (Human, Porcine) AGP-8324 HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 3325.8 1.0
VIP (Human, Porcine, Rat, 1-12) AGP-8630 HSDAVFTDNYTR 1425.5 1.0
VIP Antagonist AGP-8631 KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 3467.1 1.0
[(4Cl)DPhe6,Leu17]-VIP AGP-8632 HSDAV-4-Cl-dFTDNYTRLRKQLAVKKYLNSILN-NH2 3342.1 1.0
VIP1 Agonist : [Lys15,Arg16,Leu27]-VIP (1-7)-GRF (8-27) AGP-8633 HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 3171.7 1.0
VIP1 Antagonist : [Ac-His1,D-Phe2,Lys15,Arg16,Leu27] AGP-8634 Ac-H-dF-DAVFTNSYRKVLKRLSARKLLQDIL-NH2 3273.8 1.0
VIP1 Agonist Secretin [Arg16] (Chicken) AGP-8635 HSDGLFTSEYSKMRGRAQVQKFIQNLM-NH2 3171.7 1.0
PHI-27 (Porcine) AGP-8636 HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 2995.4 1.0
PHI-27 (Rat) AGP-8637 HADGVFTSDYSRLLGQISAKKYLESLI-NH2 3011.4 1.0
PHI (1-27)-Gly (Rat) AGP-8638 HADGVFTSDYSRLLGQISAKKYLESLIG 3067.6 1.0
PHM-VIP Space Peptide (PHM (111-122) / Prepro VIP) AGP-8639 VSSNISEDPVPV 1242.3 1.0
PHM (156-170) (Prepro VIP) AGP-8640 SSEGESPDFPEELEK 1679.7 1.0