PEPTIDES

Catalog Peptides

Overview

Urotensins
Product Name Catalog# Sequence M.W. Size
Urotensin II (Human) AGP-8322 ETPDCFWKYCV 1388.6 1.0
Urotensin II (Rat) AGP-8323 Pyr-HGTAPECFWKYCI AGP-8690 1663.9 1.0
UrotensinⅠ(catostomus commersoni) AGP-8431 NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 4869.4 1.0