PEPTIDES

Catalog Peptides

Overview

Prolactin Releasing Peptides (PrRP)
Product Name Catalog# Sequence M.W. Size
Prolactin releasing hormone (Rat) AGP-8142 SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 3595.1 1.0
Prolactin-Releasing Peptide-31 (PrRP-31) (Human) AGP-8302 SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 3664.2 1.0
Prolactin-Releasing Peptide-20 (PrRP-20) (Human) AGP-8642 TPDINPAWYASRGIRPVGRF-NH2 2272.6 1.0
Prolactin-Releasing Peptide-20 (PrRP-20) (Rat) AGP-8643 TPDINPAWYTGRGIRPVGRF-NH2 2272.6 1.0
Prolactin-Releasing Peptide-31 (PrRP-31 ) (Bovine) AGP-8644 SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 3576.1 1.0
Prolactin-Releasing Peptide-20 (PrRP-20) (Bovine) AGP-8645 TPDINPAWYAGRGIRPVGRF-NH2 2242.6 1.0