PEPTIDES

Catalog Peptides

Overview

Parathyroid Hormone & Analogs (PTH)
Product Name Catalog# Sequence M.W. Size
PTH-rP (Human, 7-34 Amide) AGP-8057 LLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 3364.9 1.0
PTH (Human, 1-34) AGP-8127 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF 4117.7 1.0
Parathyroid Hormone (Human, 1-31 Amide) AGP-8283 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV-NH2 3718.3 1.0
Parathyroid Hormone (Human, 1-44) AGP-8284 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR 5063.9 1.0
Parathyroid Hormone (Human, 13-34) AGP-8285 KHLNSMERVEWLRKKLQDVHNF 2808.2 1.0
Parathyroid Hormone (Human, 39-68) AGP-8286 APLAPRDAGSQRPRKKEDNVLVESHEKSLG 3285.7 1.0
Parathyroid Hormone (Human, 39-84) AGP-8287 APLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ 4984.5 1.0
Parathyroid Hormone (Human, 69-84) AGP-8288 EADKADVNVLTKAKSQ 1716.9 1.0
[Nle8,18,Tyr34]-PTH (Human, 1-34) AGP-8289 SVSEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVHNY 4097.7 1.0
[Nle8,18,Tyr34]-PTH (Human, 1-34 Amide) AGP-8290 SVSEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVHNY-NH2 4096.7 1.0
[Nle8,18,Tyr34]-PTH (Human, 3-34 Amide) AGP-8291 SEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVHNY-NH2 3910.5 1.0
[Tyr34]-PTH (Bovine, 1-34 Amide) AGP-8292 AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 4123.7 1.0
[Tyr34]-PTH (Bovine, 7-34 Amide) AGP-8293 FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 3496.1 1.0
PTH-rP (Human, 1-34 Amide) AGP-8294 AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 4016.6 1.0
Parathyroid Hormone (PTH) (Bovine, 1-34) AGP-8647 AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 4108.7 1.0
Parathyroid Hormone (PTH) (Human, 1-38) AGP-8648 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG 4458.2 1.0
Parathyroid Hormone (PTH)(44-68)(Human) AGP-8649 RDAGSQRPRKKEDNVLVESHEKSLG 2836.1 1.0
Parathyroid Hormone-Related Protein (PTH-RP) (Human, Rat, Mouse, 1-34) AGP-8650 AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA 4017.6 1.0
[Tyr36]-Parathyroid Hormone-Related Protein (PTH-RP) (Chicken, 1-36 Amide) AGP-8651 AVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEY-NH2 4191.7 1.0
[Tyr34]-Parathyroid Hormone-Related Protein (PTH-RP) (Human, 1-34 Amide) AGP-8652 AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTY-NH2 4108.7 1.0
Parathyroid Hormone-Related Protein (PTH-RP) (Human, 1-37) AGP-8653 AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIR 4416.1 1.0
[Asn10.Leu11]-Parathyroid Hormone-Related Protein (PTH-RP) (Human, 7-34 Amide) AGP-8655 LLHNLGKSIQDLRRRFFLHHLIAEIHTA-NH2 3348.9 1.0
[Leu11,D-Trp12]-Parathyroid Hormone-Related Protein (PTH-RP) (Human, 7-34 Amide) AGP-8656 LLHDLdWKSIQDLRRRFFLHHLIAEIHTA-NH2 3479.8 1.0
Parathyroid Hormone-Related Protein (PTH-RP) (Human, 38-64 Amide) AGP-8657 ATSEVSPNSKPSPNTKNHPVRFGSDDE-NH2 2897.1 1.0
Parathyroid Hormone-Related Protein (PTH-RP) (Human, 67-86 Amide) AGP-8658 YLTQETNKVETYKEQPLKTP-NH2 2409.7 1.0
Parathyroid Hormone-Related Protein (PTH-RP)(107-111)(Human, Rat, Mouse) AGP-8659 TRSAW-NH2 618.7 1.0
Parathyroid Hormone-like Peptide (PLP) (Human, 140-173) AGP-8660 TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL 4059.9 1.0
TIP 39 (Tuberoinfundibular Neuropeptide) AGP-8661 SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP 4504.2 1.0