PEPTIDES

Catalog Peptides

Overview

Pancreastatin
Product Name Catalog# Sequence M.W. Size
Pancreastatin (Human, 37-52 Amide) AGP-8055 EEEEEMAVVPQGLFRG-NH2 1818.8 1.0
Xenin 25 (Human) AGP-8329 MLTKFETKSARVKGLSFHPKRPWIL 2971.6 1.0
Pancreastatin (Chromograninin A (Human, 250-301 Amide)) AGP-8552 GESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 5508.8 1.0
Pancreastatin (24-52) (hPST-29) (Human) AGP-8553 PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 3282.5 1.0
Pancreastatin (Porcine) AGP-8554 GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2 5103.5 1.0
Pancreastatin (Porcine, 33-49) AGP-8555 QEEEEETAGAPQGLFRG-NH2 1846.9 1.0
Pancreastatin (Chromograninin A (264-314)-Amide) (Rat) AGP-8556 DDGQSESQAVNGKTGASEAVPSEGKGELEHSQQEEDGEEAMAGPPQGLFPG-NH2 5169.4 1.0