PEPTIDES

Catalog Peptides

Overview

PACAP
Product Name Catalog# Sequence M.W. Size
PACAP 27 (Huaman, 1-27 Amide) AGP-8120 HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 3147.6 1.0
PACAP38 (Human) AGP-8298 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 4534.3 1.0
PACAP (Human, Ovine, Rat, 6-27) AGP-8625 FTDSYSRYRKQMAVKKYLAAVL-NH2 2638.1 1.0
PACAP (Human, Ovine, Rat, 6-38) AGP-8626 FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 4024.8 1.0
PACAP-Related Peptide (PRP) (Rat, 12-29) AGP-8627 RKVLDQLSARKYLQSMVA 2106.5 1.0
PACAP38 (Human, Ovine, Rat, 31-38) AGP-8628 YKQRVKNK-NH2 1062.3 1.0
PACAP-Related Peptide (PRP) (Human) AGP-8629 DVAHGILNEAYRKVLDQLSAGKHLQSLVA 3146.6 1.0