PEPTIDES

Catalog Peptides

Overview

Opioid Related Peptides
Product Name Catalog# Sequence M.W. Size
BAM-12P AGP-8018 YGGFMRRVGRPE 1425.7 1.0
Nociceptin AGP-8130 FGGFTGARKSARKLANQ 1809.0 1.0
Morphine Modulating Peptide, C-terminal Fragment AGP-8532 PQRF-NH2 545.6 1.0
Nociceptin Antagonist AGP-8581 Ac-RYYRIK-NH2 939.1 1.0
BAM-22P (Bovine) AGP-8605 YGGFMRRVGRPEWWMDYQKRYG 2839.3 1.0
Metorphinamide (Adrenorphin) AGP-8615 YGGFMRRV-NH2 984.2 1.0
Peptide E-3200-dalton Adrenal (Bovine) AGP-8616 YGGFMRRVGRPEWWMDYQKRYGGFL 3156.6 1.0
Peptide F (Bovine) AGP-8617 YGGFMKKMDELYPLEVEEEANGGEVLGKRYGGFM 3845.4 1.0
[DAla2]-Deltorphin I AGP-8623 YdAFDVVG-NH2 768.4 1.0
Casoxin D AGP-8624 YVPFPPF 866.0 1.0
Nocistatin (Bovine) AGP-8054 TEPGLEEVGEIEQKQLQ 1926.9 1.0
[Lys8]-Vasopressin AGP-8096 CYFQNCPKG-NH2 1056.4 1.0
[Arg8]-Vasopressin AGP-8100 CYFQNCPRG-NH2 1084.4 1.0
Nocistatin (Human) AGP-8277 MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ 3561.9 1.0
[Arg8]-Vasotocin (Frog, Chicken) AGP-8326 CYIQNCPRG-NH2 1050.2 1.0
Diuretic Hormone (Manduca sexta) AGP-8432 RMPSLSIDLPMSVLRQKLSLEKERKVHALRAAANRNFLNDI-NH2 4731.6 1.0
Orphanin FQ (1-7) AGP-8566 FGGFTGA 655.7 1.0
Orphanin Pro FQ / Nociceptin(85-119)-Prepro / Nocistatin-35 (Human, Rat, Mouse) AGP-8567 MPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQ 3907.3 1.0
Orphanin Pro FQ / Nociceptin-Propro (141-157) AGP-8568 FSEFMRQYLVLSMQSSQ 2081.4 1.0
Orphanin FQ / [Tyr14]-Nociceptin AGP-8569 FGGFTGARKSARKYANQ 1859.1 1.0
Orphanin FQ / [Des-Phe1]-Nociceptin AGP-8570 GGFTGARKSARKLANQ 1661.9 1.0
Orphanin FQ / Nociceptin (Human, Rat, Mouse, 1-11) AGP-8571 FGGFTGARKSA 1098.2 1.0
Orphanin Prepro FQ / Nociceptin(85-119) /[Tyr0]-Nocistatin-35 (Rat) AGP-8572 YMPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQ 4070.4 1.0
Orphanin FQ / Nociceptin [Phe=Gly) -(1-13 Amide) AGP-8573 [Phe1gamma(CH2 -NH)-Gly2]-GFTGARKSARK-NH2 1376.6 1.0
Orphanin FQ (1-13 Amide) AGP-8574 FGGFTGARKSARK-NH2 1381.6 1.0
Orphanin Pro FQ (Rat, 173-181) AGP-8575 RTLHQNGNV 1038.1 1.0
Orphanin Pro FQ (Rat, 154-181) / Prepro-OFQ (Mouse, 160-187 Free Acid) AGP-8576 FSEFMRQYLVLSMQSSQRRRTLHQNGNV 3413.9 1.0
[Tyr0]-Nocistatin / [Tyr0]-PNP-3 (Bovine) AGP-8577 YTEPGLEEVGEIEQKQLQ 2090.3 1.0
[Lys14-E-(Tyr)]-Nocistatin / [Lys14-E-(Tyr)]-PNP-3 (Bovine) AGP-8578 TEPGLEEVGEIEQK(Y)QLQ 2090.3 1.0
Nocistatin-41 / PNP-3-8P (Bovine) AGP-8579 EIEQKQLQ 1015.1 1.0
Nocistatin-41 / PNP-2/3 (Mouse) AGP-8580 MPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQ 4375.7 1.0
[N-Phe1]-Orphanin FQ (1-13 Amide) AGP-8582 N-Benzyl-GGGFTGARKSARK-NH2 1380.4 1.0