PEPTIDES

Catalog Peptides

Overview

Neuropeptide Y
Product Name Catalog# Sequence M.W. Size
Neuropeptide Y (NPY) AGP-8091 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 4272.7 1.0
[Leu31,Pro34]-NPY (Porcine) AGP-8274 YPSKPDNPGEDAPAEDLARYYSALRHYINLLTRPRY-NH2 4223.7 1.0
NPY (Porcine, 13-36) AGP-8275 PAEDLARYYSALRHYINLITRQRY-NH2 2982.4 1.0
Neuropeptide Y (NPY) Free Acid (Human) AGP-8538 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY 4272.7 1.0
Neuropeptide Y (NPY) (Porcine) AGP-8539 YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 4253.7 1.0
Neuropeptide Y (NPY) (Porcine, 2-36) AGP-8540 PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 4090.5 1.0
Neuropeptide Y (NPY) (Porcine, 16-36) AGP-8542 DLARYYSALRHYINLITRQRY-NH2 2685.1 1.0
Neuropeptide Y (NPY) (Porcine, 18-36) AGP-8543 ARYYSALRHYINLITRQRY-NH2 2456.8 1.0
Neuropeptide Y (NPY) (Porcine, 20-36) AGP-8544 YYSALRHYINLITRQRY-NH2 2229.6 1.0
Neuropeptide Y (NPY) (Porcine, 22-36) AGP-8545 SALRHYINLITRQRY-NH2 1903.2 1.0
[D-Trp32]-Neuropeptide Y (NPY) (Porcine) AGP-8546 YPSKPDNPGEDAPAEDLARYYSALRHYINLIdWRQRY-NH2 4338.8 1.0
Neuropeptide Y (NPY) (Porcine, 3-36) AGP-8547 SKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 3993.4 1.0