PEPTIDES

Catalog Peptides

Overview

Neuropeptide
Product Name Catalog# Sequence M.W. Size
Eledosin related peptide AGP-8037 KFIGLM-NH2 707.0 1.0
Mastoparan X AGP-8112 INWKGIAAMAKKLL-NH2 1556.0 1.0
Joining Peptide (Rat) AGP-8249 AEEETAGGDGRPEPSPRE-NH 1882.9 1.0
Mastoparan AGP-8256 INLKALAALAKKIL-NH 1478.9 1.0
Physalaemin AGP-8297 Pyr-ADPNKFYGLM-NH2 1265.5 1.0
Secretoneurin (Rat) AGP-8342 TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ 3652.0 1.0
Neuropeptide GE (Human) AGP-8502 GSVDFPAENGVQNTESTQE 2009.1 1.0
Neuropeptide GE / NGE (Rat) AGP-8503 GPAVFPAENGVQNTESTQE 1975.1 1.0
Neuropeptide GE (Mouse) AGP-8504 GSVAVFPAENGVQNTESTQE 2064.2 1.0
Neuropeptide EI (NEI) AGP-8505 EIGDEENSAKFPI-NH2 1447.6 1.0
Neuropeptide AF (huNPAF) (Human) AGP-8528 AGEGLNSQFWSLAAPQRF-NH2 1978.2 1.0
Neuropeptide FF (huNPFF) (Human) AGP-8529 SQAFLFQPQRF-NH2 1367.6 1.0
Morphine Modulating Neuropeptide / A18Fa / Neuropeptide AF / bNPAF (Bovine) AGP-8530 AGEGLSSPFWSLAAPQRF-NH2 1920.2 1.0
Morphine Modulating Neuropeptide (F8Fa) / Neuropeptide FF (bNPFF) (Bovine) AGP-8531 FLFQPQRF-NH2 1081.3 1.0
Neuropeptide F (Monieza expansa) AGP-8714 PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2 4590.4 1.0
[Des-Br]-Neuropeptide B-23 (NPB-23) / L7 (Human) AGP-8716 WYKPAAGHSSYSVGRAAGLLSGL 2348.7 1.0
Neuropeptide W-23 (NPW-23) / L8 (Human) AGP-8718 WYKHVASPRYHTVGRAAGLLMGL 2584.1 1.0
[Des-Br]-Neuropeptide B-29 (NPB-29) (Human) AGP-8719 WYKPAAGHSSYSVGRAAGLLSGLRRSPYA 3079.5 1.0
Neuropeptide W-30 (NPW-30) (Human) AGP-8722 WYKHVASPRYHTVGRAAGLLMGLRRSPYLW 3543.2 1.0
Neuropeptide W-23 (NPW-23) (Rat) AGP-8723 WYKHVASPRYHTVGRASGLLMGL 2600.1 1.0
Neuropeptide W-23 (NPW-23) (Porcine) AGP-8724 WYKHTASPRYHTVGRAAGLLMGL 2586.0 1.0
Neuropeptide S (NPS) (Rat) AGP-8772 SFRNGVGSGVKKTSFRRAKQ 2210.5 1.0
Neuropeptide S (NPS) (Human) AGP-8773 SFRNGVGTGMKKTSFQRAKS 2187.5 1.0
Neuropeptide S (NPS) (Mouse, 1-15) AGP-8774 SFRNGVGSGAKKTSF 1542.7 1.0
Neuropeptide S (NPS) (Rat, 1-15) AGP-8775 SFRNGVGSGVKKTSF 1570.8 1.0
[Tyr10]-Neuropeptide S (NPS) (Rat, Mouse) AGP-8776 SFRNGVGSGYKKTSFRRAKQ 2274.6 1.0
Neuropeptide S (NPS) (Mouse) AGP-8792 SFRNGVGSGAKKTSFRRAKQ 2182.5 1.0
NAP / NAPVSIPQ AGP-8804 NAPVSIPQ 824.9 1.0
Neuropeptide S (NPS) (Chimpanzee, Canine) AGP-8806 SFRNGVGTGMKKTSFRRAKS 2215.5 1.0
Neuropeptide S (NPS) (Chicken) AGP-8807 SFRNGVGSGIKKTSFRRAKS(2183.50) 2183.5 1.0