PEPTIDES

Catalog Peptides

Overview

Adrenomedullins
Product Name Catalog# Sequence M.W. Size
Proadrenomedullin (PAMP) (Human) AGP-8002 ARLDVASEFRKKWNKWALSR-NH2 2461.5 1.0
Proadrenomedullin (PAMP) (Rat) AGP-8003 ARLDTSSQFRKKWNKWALSR-NH2 2478.3 1.0
Proadrenomedullin-12 (PAMP-12) (Human) AGP-8004 FRKKWNKWALSR-NH2 1620.9 1.0
Adrenomedullin (Human, 1-25) AGP-8152 YRQSMNNFQGLRSFGCRFGTCTVQK 2926.3 1.0
Adrenomedullin (Human, 1-12) AGP-8410 YRQSMNNFQGLR 1513.7 1.0
Adrenomedullin (Human, 13-52) AGP-8411 SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 4533.1 1.0
Adrenomedullin (Human, 22-52) AGP-8412 TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 3576.0 1.0
Adrenomedullin (Human, 16-52) AGP-8413 CRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 4242.8 1.0
Adrenomedullin (Human, 34-52) AGP-8414 TDKDKDNVAPRSKISPQGY-NH2 2118.3 1.0
Adrenomedullin (PAMP-20) (Mouse) AGP-8415 AGPDTPSQFRKKWNKWALSR-NH2 2372.7 1.0
Adrenomedullin (Rat, 24-50) AGP-8416 LAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 3121.5 1.0
Adrenomedullin (PAMP-20) (Porcine) AGP-8418 ARLDVAAEFRKKWNKWALSR-NH2 2444.9 1.0
Adrenomedullin (Porcine, 26-52) AGP-8419 LAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 3062.4 1.0
Adrenomedullin (Porcine, 34-52) AGP-8420 TDKDKDGVAPRSKISPQGY-NH2 2061.3 1.0