PEPTIDES

Catalog Peptides

Overview

Growth Hormone Releasing Factors (GHRF)
Product Name Catalog# Sequence M.W. Size
GHRF (Human) AGP-8239 YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH 5039.7 1.0
GHRF (Mouse) AGP-8466 HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS 5032.8 1.0
GHRF (Human, 1-29 Amide) AGP-8467 YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 3357.9 1.0
GHRF (Rat) AGP-8468 HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN 5232.9 1.0
[Ac-Y1,D-F2]-GHRF (1-29 Amide) AGP-8469 Ac-YdFDAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 3476.3 1.0
[N-Ac-Y1,D-R2]-GHRF (Human, 1-29 Amide) AGP-8470 Ac-YdRDAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 3485.1 1.0
[H1,Ⅰ27]-GHRF (Human, 1-32 Amide) AGP-8471 HADAIFTNSYRKVLGQLSARKLLQDINleSRQQG-NH2 3627.2 1.0
GHRF (Human, 30-44 Amide) AGP-8472 Pyr-QGESNQERGARARL-NH2 1681.8 1.0
GHRP-6 AGP-8475 HdWAWdFK-NH2 873.1 1.0