PEPTIDES

Catalog Peptides

Overview

Ghrelins
Product Name Catalog# Sequence M.W. Size
Ghrelin (Human) AGP-8147 GSS(n-octanoyl)FLSPEHQRVQQRKESKKPPAKLQPR 3370.9 1.0
[Des-Octanoyl]-Ghrelin (Human) AGP-8148 GSSFLSPEHQRVQQRKESKKPPAKLQPR 3244.7 1.0
Ghrelin (Rat) AGP-8149 GSS(n-octanoyl)FLSPEHQKAQQRKESKKPPAKLQPR 3314.8 1.0
[Des-Octanoyl]-Ghrelin (Rat) AGP-8150 GSSFLSPEHQKAQQRKESKKPPAKLQPR 3188.6 1.0
Ghrelin (Human, 1-14) AGP-8476 GSS(n-octanoyl)FLSPEHQRVQQ 1725.9 1.0
Ghrelin (1-5 Amide) AGP-8477 GSS(n-octanoyl)FL-NH2 635.8 1.0
[Des-Octanoyl3]-Ghrelin (1-5 Amide) AGP-8478 GSS(Des-octanoyl)FL-NH2 508.1 1.0
Ghrelin (Human, Rat, 17-28) AGP-8479 ESKKPPAKLQPR 1378.6 1.0
[Des-Octanoyl3]-Ghrelin (Rat) AGP-8480 GSS(DesOctanoyl)FLSPEHQKAQQRKESKKPPAKLQPR 3188.6 1.0
Ghrelin C-terminal, Hexapeptide AGP-8481 AKLQPR 711.9 1.0
[Des-Octanoyl3]-Ghrelin (Human, 1-14) AGP-8482 GSS(Des-octanoyl)FLSPEHQRVQQ 1599.7 1.0
Ghrelin (Rat, 3-28) AGP-8483 S(Octanoyl)FLSPEHQKAQQRKESKKPPAKLQPR 3170.0 1.0
[Des-Q14]-Ghrelin (Rat) AGP-8484 GSS(n-octanoyl)FLSPEHQKAQRKESKKPPAKLQPR 3185.9 1.0
[Des-Octanoyl]-Ghrelin (Human, 1-18) AGP-8485 GSSFLSPEHQRVQQRKES 2100.3 1.0
Ghrelin (86-117), Prepro (Human) AGP-8486 LSGVQYQQHSQALGKFLQDILWEEAKEAPADK 3629.0 1.0
Ghrelin (52-85), Prepro (Human) AGP-8487 ALAGWLRPEDGGQAEQAEDELEVRFNAPFDVGIK 3729.1 1.0
[Des-Octanoyl-Ser3]-Ghrelin (Human) AGP-8488 GSS(DesOctanoyl)FLSPEHQRVQQRKESKKPPAKLQPR 3244.7 1.0
Ghrelin (86-117), Prepro (Rat) AGP-8489 LSGAQYQQHGRALGKFLQDILWEEVKEAPANK 3626.1 1.0
Ghrelin (52-85), Prepro (Rat) AGP-8490 ALEGWLHPEDRGQAEEAEEELEIRFNAPFDVGIK 3896.2 1.0