PEPTIDES

Catalog Peptides

Overview

Gastric-Related Peptides
Product Name Catalog# Sequence M.W. Size
Gastrin I (Human) AGP-8044 Pyr-GPWLEEEEEAYGWMDF-NH2 2098.8 1.0
Gastric Inhibitory Polypeptide(GIP) (Human, 1-42 ) AGP-8045 YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ 4982.5 1.0
Gastrin Relesing Peptide (GRP) (Human) AGP-8237 VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH 2860.4 1.0
Gastrin Releasing Peptide(GRP) (Porcine) AGP-8389 APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 2805.3 1.0
Gastrin Releasing Peptide (Porcine, Human, 14-27) AGP-8390 MYPRGNHWAVGHLM-NH2 1667.9 1.0
Big Gastrin I (Human) AGP-8423 Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2 AGP-8235 3849.3 1.0
Gastrin Relesing Peptide(GRP) (Human, 1-16) AGP-8424 VPLPAGGGTVLTKMYP 1600.9 1.0
CTFP of Rat Progastrin AGP-8425 SAEEEDQYN 1084.2 1.0
Gastrin Little (Rat) AGP-8426 Pyr-RPPMEEEEEAYGWMDF-NH2 2126.3 1.0
Minigastrin AGP-8427 WLEEEEEAYGWMDF-NH2 1832.9 1.0