PEPTIDES

Catalog Peptides

Overview

Galanins-Related Peptides
Product Name Catalog# Sequence M.W. Size
Galanin (Rat) AGP-8043 GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 3164.5 1.0
Galanin (Human) AGP-8233 GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS 3157.4 1.0
Galanin-Like Pepdide (Human, 1-60) AGP-8234 APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS 6500.3 1.0
Galanin (Bovine) AGP-8453 GWTLNSAGYLLGPHALDSHRSFQDKHGLA-NH2 3148.5 1.0
Galanin (Porcine) AGP-8454 GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 3210.5 1.0
Galanin (108-123), Prepro (Porcine) AGP-8455 LPGLPSAASSEDAGQS 1486.5 1.0
Galanin (Porcine, Rat, 1-16) AGP-8456 GWTLNSAGYLLGPHAI 1669.9 1.0
Galanin (Human, 1-19) AGP-8457 GWTLNSAGYLLGPHAVGNH 1964.2 1.0
Galanin (1-30), Prepro (Human) AGP-8458 MARGSALLLASLLLAAALSASAGLWSPAKE 2940.5 1.0
Galanin (89-105 Amide), Prepro (Porcine) AGP-8460 TIMEFLAFLHLKEAGAL-NH2 1903.3 1.0
Galanin (80-105, Amide), Prepro (Porcine) AGP-8461 LQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 2944.5 1.0
Galanin(1-13)-P-P-(A-L)2-A-Amide, M40 AGP-8462 GWTLNSAGYLLGPPPALALA-NH2 1981.3 1.0
Galanin Like Pepitde (GALP) (Human, 36-60) AGP-8463 ETALEILDLWKAIDGLPYSHPPQPS 2791.2 1.0
Galanin Like Pepitde (GALP) (Rat) AGP-8465 APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT 6502.4 1.0