PEPTIDES

Catalog Peptides

Overview

Corticotropin Releasing Factors (CRF)
Product Name Catalog# Sequence M.W. Size
CRF (Human, Rat) AGP-8034 SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 AGP-8344 4756.5 1.0
CRF (Ovine) AGP-8035 SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 4669.5 1.0
Tyrosyl-CRF (Human, Rat) AGP-8205 YSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH 4290.7 1.0
CRF Antagonist [Alpha-Helical CRF(9-41)] AGP-8429 DLTFHLLREMLEMAKAEQEAEQAALNRLLLEEA-NH2 3826.4 1.0