PEPTIDES

Catalog Peptides

Overview

Brain Natriuretic Peptides (BNP)
Product Name Catalog# Sequence M.W. Size
BNP-32 (Human) AGP-8180 SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH 3464.1 1.0
BNP-26 (Porcine) AGP-8182 DSGCFGRRLDRIGSLSGLGCNVLRRY 2869.3 1.0
BNP-32 (Rat) AGP-8183 NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF 3453.0 1.0
BNP (1-21) AGP-8368 HPLGSPGSASDLETS GLQEQR 2166.3 1.0
BNP (22-46) AGP-8369 NHLQGKLSELQVEQTSLEPLQESPR 2859.2 1.0
BNP (1-46) AGP-8370 HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPR 5009.4 1.0
BNP (24-45) AGP-8372 EKSEEMAQRQLSKDQGPTKELL 2545.8 1.0