PEPTIDES

Catalog Peptides

Overview

Apelins
Product Name Catalog# Sequence M.W. Size
[Pyr1]-Apelin-13 (Human, Bovine) AGP-8015 Pyr-RPRLSHKGPMPF 1534.8 1.0
Apelin-36 (Human) AGP-8163 LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF 4195.9 1.0
Apelin-36 (Bovine) AGP-8350 LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF 4178.9 1.0
Apelin-17 (Human, Bovine) AGP-8351 KFRRQRPRLSHKGPMPF 2138.6 1.0
Apelin-16 (Human, Bovine) AGP-8352 FRRQRPRLSHKGPMPF 2010.4 1.0
Apelin-13 (Human, Bovine) AGP-8353 QRPRLSHKGPMPF 1550.9 1.0
Apelin-12 (Human, Bovine, Mouse, Rat) AGP-8354 RPRLSHKGPMPF 1422.7 1.0
Apelin (23-57), Prepro(Human) AGP-8355 GSLMPLPDGNGLEDG NVRHLVQPRGSRNGP GPWQG-NH2 3666.0 1.0