PEPTIDES

Catalog Peptides

Overview

Stresscopin & Urocortin
Product Name Catalog# Sequence M.W. Size
Urocortin (Human) AGP-8083 DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 4697.3 1.0
Stresscopin (Human) AGP-8315 TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 4367.2 1.0
Stresscopin-Related Peptide (Human) AGP-8316 HPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARV-NH2 4687.5 1.0
Urocortin (Rat) AGP-8317 DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 4707.3 1.0
Urocortin II (Mouse) AGP-8318 VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 4152.9 1.0
Urocortin I (Mouse) AGP-8348 VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHVGRR-NH2 4522.3 1.0
Urocortin III (Mouse) AGP-8349 FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 4173.9 1.0
AntiSauvagine-30 (aSvg-30) AGP-8430 d-FHLLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2 3650.3 1.0
Urotensin II (Frog) AGP-8688 AGNLSECFWKYCV 1517.8 1.0
Prepro-Urotensin II (102-125) (Human) AGP-8691 FQDFSGQDPNILLSHLLARIWKPY 2859.3 1.0