PEPTIDES

Catalog Peptides

Overview

Pancreatic Polypeptides
Product Name Catalog# Sequence M.W. Size
Pancreatic Polypeptide (PPP) (Human) AGP-8550 APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 4181.8 1.0
Pancreatic Polypeptide (PPP) (Rat) AGP-8551 APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 4398.9 1.0