PEPTIDES

Catalog Peptides

Overview

Glucagons-Like Peptides
Product Name Catalog# Sequence M.W. Size
GLP-1 (Human, 7-37) AGP-8046 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3355.7 1.0
GLP-1 (Human, 7-36 Amide) AGP-8047 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 3297.6 1.0
GLP-2 (Human) AGP-8048 HADGSFSDEMNTILDNLAARDFINWLIQTKITD 3766.1 1.0
Glucagon (Human) AGP-8238 HSQGTFTSDYSKYLDSRRAQDFVQWLMNT 3482.8 1.0
Glucagon-Like peptide (1-36) AGP-8345 HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 4141.5 1.0
GLP-2 (Human, 126-159) AGP-8493 HADGSFSDEMNTILDNLAARDFINWLIQTKITDR 3922.4 1.0
Glucagon (Dogfish, Scyliorhinus Canidula) AGP-8495 HSEGTFTSDYSKYMDNRRAKDFVQWLMNT 3528.9 1.0
Glucagon (Human, 22-29) AGP-8497 FVQWLMNT 1038.2 1.0
Glicentin-related Polypeptide (Human) AGP-8756 QDTEEKSRSLRSFSASQADPLSDPDQMNED 3384.5 1.0
Glucagon-Like Peptide-1 (GLP-1) ((Human, 9-36 Amide) AGP-8757 EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 3089.4 1.0
Taspoglutide AGP-8824 H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVK-Aib-R-NH2 3339.6 1.0
Lixisenatide AGP-8825 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 4858.5 1.0
Liraglutide AGP-8826 HAEGTFTSDVSSYLEGQAAK( 3751.2 1.0