PEPTIDES

Catalog Peptides

Overview

Adrenocorticotropic Hormones (ACTH)
Product Name Catalog# Sequence M.W. Size
ACTH (Human, 18-39) AGP-8075 RPVKVYPNGAEDESAEAFPLEF 2465.7 1.0
ACTH (Human, 1-24) AGP-8076 SYSMEHFRWGKPVGKKRRPVKVYP 2933.5 1.0
ACTH Partial AGP-8118 RPVKVYPNGAEDESAEC 1864.0 1.0
ACTH (Human) AGP-8696 SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF 4394.0 1.0
ACTH (Rat) AGP-8697 SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF 4582.2 1.0
[D-Arg8]-ACTH (4-10) AGP-8698 MEHFdRWG 962.1 1.0