PEPTIDES

Catalog Peptides

Overview

Exendins
Product Name Catalog# Sequence M.W. Size
Exendin-3 AGP-8089 HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 4202.6 1.0
Exendin-4 AGP-8090 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 4186.9 1.0
Exendin (5-39) AGP-8232 TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH 3806.5 1.0
Exendin-3 (9-39 Amide) (Heloderma horridum) AGP-8494 DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 3369.8 1.0