PEPTIDES

Catalog Peptides

Overview

Endothelins
Product Name Catalog# Sequence M.W. Size
Suc-[Glu9,Ala11,15] Endothelin (8-21) AGP-8040 Suc-DEEAVYFAHLDIIW 1821.8 1.0
Endothelin-1 (Human) AGP-8139 CSCSSLMDKECVYFCHLDIIW 2491.9 1.0
Endothelin-1 (Human, 1-31) AGP-8218 CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY 3628.2 1.0
Endothelin-2 (Human) AGP-8219 CSCSSWLDKECVYFCHLDIIW 2547.0 1.0
Endothelin-3 (Human) AGP-8220 CTCFTYKDKECVYYCHLDIIW 2643.1 1.0
Big Endothelin-2 (Human, 1-37) AGP-8223 CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP 4183.7 1.0
Big Endothelin-3 (Human, 1-41 Amide) AGP-8225 CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2 4923.6 1.0
VIC (Mouse) AGP-8227 CSCNSWLDKECVYFCHLDIIW 2574.0 1.0
Endothelin-1 Prepro (Human, 18-50) AGP-8433 APETAVLGAELSAVGENGGEKPTPSPPWRLRRS 3430.8 1.0
Endothelin-1(ET-1) (22-38), Big(Human) AGP-8434 VNTPEHVVPYGLGSPRS 1809.0 1.0
[Ala 11,15]-Endothelin-1 (Human, Porcine, Canine, Rat, Mouse, Bovine, 6-21) AGP-8435 LMDKEAVYFAHLDIIW 1964.3 1.0
Endothelin-3 (Human, 22-41 Amide) AGP-8437 INTPEQTVPYGLSNYRGSFR-NH2 2298.5 1.0
Endothelin Antagonist, BQ123 AGP-8440 Cyclo(D-Asp-Pro-D-Val-Leu-D-Trp) 610.3 1.0