PEPTIDES

Catalog Peptides

Overview

Endorphin
Product Name Catalog# Sequence M.W. Size
α-Neo-Endorphin (Porcine) AGP-8051 YGGFLRKYPK 1228.5 1.0
β-Neo-Endorphin (Porcine) AGP-8052 YGGFLRKYP 1100.3 1.0
β-Endorphin (Human) AGP-8078 YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE 3465.0 1.0
α-Endorphin / β-Lipotropin (61-76) AGP-8216 YGGFMTSEKSQTPLVT 1744.8 1.0
γ-Endorphin / β-Lipotropin (61-77) AGP-8217 YGGFMTSEKSQTPLVTL 1857.9 1.0
Endorphin, Ac-beta (1-16) (Human) AGP-8595 Ac-YGGFMTSEKSQTPLVT 1787.9 1.0
Endorphin (1-27) Ac-Beta (Camel, Bovine, Ovine) AGP-8596 Ac-YGGFMTSEKSQTPLVTLFKNAIIKNAH 3038.5 1.0
Endorphin (1-27) Beta (Camel, Bovine, Ovine) AGP-8597 YGGFMTSEKSQTPLVTLFKNAIIKNAH 2996.5 1.0
Endorphin (1-27) Ac-Beta (Human) AGP-8598 Ac-YGGFMTSEKSQTPLVTLFKNAIIKNAY 3064.5 1.0
Endorphin (1-26) Beta (Human) AGP-8599 YGGFMTSEKSQTPLVTLFKNAIIKNA 2859.3 1.0
Endorphin (1-27) Beta (Human) AGP-8600 YGGFMTSEKSQTPLVTLFKNAIIKNAY 3022.5 1.0
Endorphin (18-31) Beta (Human) AGP-8601 KKGE 460.5 1.0
Endorphin Beta (Porcine) AGP-8602 YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ 3423.9 1.0
Endorphin Beta (Rat) AGP-8603 YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ 3466.1 1.0